Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L211 (MIMI_L211) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Uncharacterized protein L211

UniProt

Q5UQ30

Expression Region

1-262

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHISLNICKDIFCGFFDSVRIDIAIKKLYNDQKLQKKIIKIAKFNTIMYLVPYIITYTV LNTFDYDLFSIINIVYLFVNVISGLFHLLYFIDLIDIVCVYTKKLNRPISKLDSIGLAIV SFVYQLSMYIIMELIDMMLYKKLDVVSYLIKFIILTLYHSFCCFNNLWHYKNIDIHHRIS LHEKLWAYYLGYGTIASLMYIYSNHPLMIYTYNIYMSILIILPFMIKTKYPKKQAYPSIN LKIFSIIVGYFNYAIKLINNSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin C Antibody
KC-2389-01 50 μL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
Cardiac Troponin C Antibody
KC-2389-02 100 µL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
Cardiac Troponin C Antibody
KC-2389-03 1 mL

Cardiac Troponin C Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2024-01 50 μL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2024-02 100 µL

KIFBP Antibody

Sign In for Pricing
View Details
KIFBP Antibody
KC-2024-03 1 mL

KIFBP Antibody

Sign In for Pricing
View Details