Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (ATP6)

This Recombinant ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P50364

Expression Region

1-262

Origin

Allomyces macrogynus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFINLNPLEQFSVYSATSAILGSSSNSLAITSLTNIAILFIIGLLVLTIFQISASSHLIK PTRWNIVLETWVASILGIVKDQIGNDAKNSLIYFPLIFTFFSFVFISNILGMIPYSFTPT SHISVTLGLSIAIMIGVTLIGFSKHQLDFFSLFVPKGTPLALVPLLVLIEFISYSARAFS LALRLTANVSAGHCLFGVISALSVSACIAVSSLLLKGITITLPLAVLVVLYGLELLVALL QSYVFTLLTCSYLADVVNMGDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slo2.1 Antibody
abx444977 100 µg

Slo2.1 Antibody

Sign In for Pricing
View Details
USP Sol. Bromothymol Blue TS - 500ML
USP1605 500 mL

USP Sol. Bromothymol Blue TS - 500ML

Sign In for Pricing
View Details
Gtpbp2 ORF Vector (Mouse) (pORF)
ORF046820 1.0 µg DNA

Gtpbp2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
HEMK1 (m) -PR
sc-145937-PR 10 µM - 20 µL

HEMK1 (m) -PR

Sign In for Pricing
View Details
Human amyloid β A4 protein ELISA kit
GTR10448877 96 Well

Human amyloid β A4 protein ELISA kit

Sign In for Pricing
View Details
Human Growth Differentiation Factor 6 ELISA Kit
MBS763810-01 48 Well

Human Growth Differentiation Factor 6 ELISA Kit

Sign In for Pricing
View Details