Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 3 (COIII)

This Recombinant Cytochrome c oxidase subunit 3 (COIII) spans the amino acid sequence from region 1-263.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q36675

Expression Region

1-263

Origin

Plasmodium vivax

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTAHKITVLINIFFIFSNYNNIKAHLVSYPSLTSLYGTSLKYFSVGILFTSNPIIFIIF VYSIRESFYSIFSSLVSGMLSIIISEAILFITYFWGILHFSLSPYPLYNEGIILTSSRML ILTITFILASASCMTACLQFLIEKGMSLEISSIVFIIYLLGECFASLQTTEYLHLGYCIN DAISGTLFYCVTGLHFSHVIVGLLLLLIYFIRIVEMYDTNSEWSYSLYGISYIVLPHTDQ ITILYWHFVEIVWLFIEYFFYSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF740 conjugate, 0.1mg/mL
BNC740979-500 1x 500 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgM Immunoglobulin (Cocktail), CF568 conjugate, 0.1mg/mL
BNC680762-100 1x 100 µL

IgM Immunoglobulin (Cocktail), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details