Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthobacter autotrophicus Cobalamin synthase (cobS)

This Recombinant Xanthobacter autotrophicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7IB66

Expression Region

1-265

Origin

Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLDRIAQDLVAALRFYSRLPLPAGRDDPDAFAVPSLNRIAYAIPLAGAVIGLIGAVVLV GALALKLPAFLASVLAVTALVLTTGAFHEDGLADTADGLGGGRDKAQRLAIMRDSRIGTY GGCALILALLLRVAALEALVASAGMFRAALALVVAEAASRAAGVLLLLALPPARADGAGA SFGRPSESAGLACALVAALLVVVILVPGFGISTAFAGLIAPLVALFAMMRLSGRLIGGQT GDVAGATQQVAVIVFLLGVLIFPGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-HT Polyclonal Antibody, APC Conjugated
bs-1126R-APC-TR 20 µL

5-HT Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
GSS Rabbit Polyclonal Antibody (Fluoro647)
orb3116221 100 µg

GSS Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Sulphadiazine  SZ  100 mcg
SD092-5CT 1 unit

Sulphadiazine SZ 100 mcg

Sign In for Pricing
View Details
Lentiviral human NAGA shRNA (UAS) - Lentiviral human NAGA shRNA (UAS, RFP) (25)
GTR15155723 1 Vial

Lentiviral human NAGA shRNA (UAS) - Lentiviral human NAGA shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ANXA13, NT (ANXA13, ANX13, Annexin A13, Annexin XIII, Annexin-13, Intestine-specific annexin) (APC) discontinued
031929-APC 200 µL

ANXA13, NT (ANXA13, ANX13, Annexin A13, Annexin XIII, Annexin-13, Intestine-specific annexin) (APC) discontinued

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) pou3f2 Polyclonal Antibody
MBS7148964 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) pou3f2 Polyclonal Antibody

Sign In for Pricing
View Details