Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthobacter autotrophicus Cobalamin synthase (cobS)

This Recombinant Xanthobacter autotrophicus Cobalamin synthase (cobS) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7IB66

Expression Region

1-265

Origin

Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLDRIAQDLVAALRFYSRLPLPAGRDDPDAFAVPSLNRIAYAIPLAGAVIGLIGAVVLV GALALKLPAFLASVLAVTALVLTTGAFHEDGLADTADGLGGGRDKAQRLAIMRDSRIGTY GGCALILALLLRVAALEALVASAGMFRAALALVVAEAASRAAGVLLLLALPPARADGAGA SFGRPSESAGLACALVAALLVVVILVPGFGISTAFAGLIAPLVALFAMMRLSGRLIGGQT GDVAGATQQVAVIVFLLGVLIFPGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Valganciclovir HCl
C09865-10mg 10 mg

Valganciclovir HCl

Sign In for Pricing
View Details
Lipid-lowering agent-2
orb2664142-01 50 mg

Lipid-lowering agent-2

Sign In for Pricing
View Details
Lipid-lowering agent-2
orb2664142-02 10 mg

Lipid-lowering agent-2

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)
MBS1202681-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)
MBS1202681-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)
MBS1202681-03 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yuxH (yuxH)

Sign In for Pricing
View Details