Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium etli Undecaprenyl-diphosphatase (uppP)

This Recombinant Rhizobium etli Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q2KDF4

Expression Region

1-265

Origin

Rhizobium etli (strain CFN 42 / ATCC 51251)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYINAAILGVIEGITEFLPISSTGHLIIAEQWLGHRSDMFNIVIQAGAILAVTIIYWRR LLDLVLGWREPENRDYAAKLIVAFLITAILGLVVKKLGFELPETATPIAWALIIGGIWMI FAEWAAARRPPHKQITWLVAILVGIAQIVAGVFPGTSRSGATIFVALLAGTGNRAAATEF AFLVGIPTMYAASGYELLKTFKDGGAAGEDWTALAIAFVVSTIVAFIAVKWLLAYIRSNR FTLFAIYRIILGVLLLGMTATGMIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL
BNC400478-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (E29), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL
BNC681777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF568 conjugate, 0.1mg/mL
BNC681982-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1982), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details