Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Bacillus cereus Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q63GU6

Expression Region

1-265

Origin

Bacillus cereus (strain ZK / E33L)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIIIAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTFEIVIQLGAILAIAIL YHKRLVSLCNIKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDVIKTYLFQPYTVVIGLVA GAILMILAEVKKQEATACSLDDLTYRQALTIGFFQCLAVYPGFSRAGSTISGGLLAKVNY KTASEFSFLIALPVMVGATSLDLLKSWKYLSVDDIPMFAVGFITSFIVAMLAVVTFLKLL EKIGLKPFAYYRILLAILFTLFVLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL
BNC680437-100 1x 100 µL

CD47 (B6H12.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF640R conjugate, 0.1mg/mL
BNC402598-100 1x 100 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (HPCA1/2598R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details