Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 1 (uppP1)

This Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 1 (uppP1) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 1, EC= 3.6.1.27, Bacitracin resistance protein 1, Undecaprenyl pyrophosphate phosphatase 1

UniProt

Q6HPB7

Expression Region

1-265

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDIITAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTFEIVIQLGAILAIAIL YHKRLVSLCNIKPLLRKEKKFNAFHVFLGVFPAVVAGLLLHDIIKTYLFQPYTVVIGLVA GAILMIFAEVKKQEATSYSLDDLTYRQALTIGLFQCLAVYPGFSRAGSTISGGLLAKVNY KTASEFSFLIALPVMVGATGLDLLKSWTYLSVDDIPMFAVGFITSFIVAMLAVVTFLKLL EKIGLKPFAYYRILLAILFTVFVLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL
BNC940178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF594 conjugate, 0.1mg/mL
BNC941812-100 1x 100 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL
BNC942366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details