Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P26858

Expression Region

1-265

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSQKHPFHLVDPSPWPLLGSLGALASTIGGVMYMHSFTGGGTLLCLGLGMILYTMFVW WRDVIRESTYEGHHTFVVQLGLRYGIILFIVSEVMFFLAFFWAFFHSSLAPTVEIGAIWP PKGISVLDPWGIPFLNTLILLSSGAAVTWAHHAILAGLKQQAVYALIATVFLALVFTGFQ GIEYIEAPFTISDGIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYLGHFTPKHHFGFEA AAFYWHFVDVVWLFLFVSIYWWGGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP1B (Microtubule Associated Protein 1B, MAP5, FUTSCH) (MaxLight 750)
MBS6425295-01 0.1 mL

MAP1B (Microtubule Associated Protein 1B, MAP5, FUTSCH) (MaxLight 750)

Sign In for Pricing
View Details
MAP1B (Microtubule Associated Protein 1B, MAP5, FUTSCH) (MaxLight 750)
MBS6425295-02 5x 0.1 mL

MAP1B (Microtubule Associated Protein 1B, MAP5, FUTSCH) (MaxLight 750)

Sign In for Pricing
View Details
GRXCR1 Protein Vector (Human) (pPM-C-HA)
PV081795 500 ng

GRXCR1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Fluo-4FF AM
HY-D1768 1 Each

Fluo-4FF AM

Sign In for Pricing
View Details
WARS2 AAV Vector (Human) (CMV)
50252101 1 µg

WARS2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Stxbp5l (NM_001271250) Rat Tagged ORF Clone
RR217532 10 µg

Stxbp5l (NM_001271250) Rat Tagged ORF Clone

Sign In for Pricing
View Details