Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Marchantia polymorpha Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

P26858

Expression Region

1-265

Origin

Marchantia polymorpha (Liverwort) (Marchantia aquatica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVSQKHPFHLVDPSPWPLLGSLGALASTIGGVMYMHSFTGGGTLLCLGLGMILYTMFVW WRDVIRESTYEGHHTFVVQLGLRYGIILFIVSEVMFFLAFFWAFFHSSLAPTVEIGAIWP PKGISVLDPWGIPFLNTLILLSSGAAVTWAHHAILAGLKQQAVYALIATVFLALVFTGFQ GIEYIEAPFTISDGIYGSTFFLATGFHGFHVIIGTIFLIICGIRQYLGHFTPKHHFGFEA AAFYWHFVDVVWLFLFVSIYWWGGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hrg Pre-designed siRNA Set A
SI106355A 1 Each

Mouse Hrg Pre-designed siRNA Set A

Sign In for Pricing
View Details
LIG1 antibody - middle region (ARP54308_P050)
ARP54308_P050 100 µL

LIG1 antibody - middle region (ARP54308_P050)

Sign In for Pricing
View Details
C20orf30 (TMEM230) Mouse Monoclonal Antibody [Clone ID: LBI1B4]
AMM12789VCF 100 µg

C20orf30 (TMEM230) Mouse Monoclonal Antibody [Clone ID: LBI1B4]

Sign In for Pricing
View Details
Mouse Rho Pre-designed siRNA Set A
SI111963A 1 Each

Mouse Rho Pre-designed siRNA Set A

Sign In for Pricing
View Details
IgG, H&L, X-adsorbed (TRITC)
I1903-30L 1 mg

IgG, H&L, X-adsorbed (TRITC)

Sign In for Pricing
View Details
DL-Pyroglutamic acid
FP39320-01 1 Kg

DL-Pyroglutamic acid

Sign In for Pricing
View Details