Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP)

This Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A3PCQ0

Expression Region

1-266

Origin

Prochlorococcus marinus (strain MIT 9301)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYLKFVLYGLIQGLTEFIPVSSTAHLKVISLFLGIDDPGASLSATIQLGSVIAIAYYFR NDIFNFRSQSSKKFLEYLFHERLLRSIFIGTIPIVLLGGSIKIFIPSFFENVLRSNLSIA LVSFLMAFFMYLADSSKRGSINIKNHNFSNSFLIGIFQAFAIFPGVSRSGVTISSALISG WERGDAAKFSFLLGMPAISLAAIVEFVSSFNDFFSLGFFPLFVGLITTFLSSLLAIDFLL KYFSSNGLKIFIIYRVIFGVVILLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fbxo46 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4471503 1.0 µg DNA

Fbxo46 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human TNF Signaling Primer Library
HTNF-I 1 set

Human TNF Signaling Primer Library

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag
053937-01 10 µg

Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag
053937-02 50 µg

Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag
053937-03 100 µg

Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag
053937-04 200 µg

Matrix Metalloproteinase 3 (MMP3), Recombinant, Human, His-Tag

Sign In for Pricing
View Details