Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP)

This Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A8G4L8

Expression Region

1-266

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYLRFILYGLIQGLTEFLPISSTAHLKIISIFLGIDDPGSSLSATIQLGSVLAIVWYFR NDIFNFRGQSSKNILYYFLHERLLRSIFIGTIPIVLLGGSVKLFVPNFIDNVLRSNLSIA LVSIVMAFFMYLADSSKRGSIDIKNHNYSDSFLIGFFQALAIFPGVSRSGITISSALISG WERRDAAKFSFLLGMPAISLAAIVEFIFSFNEFFSIGFLPLLVGLMTTFLSSLLAIDFLL RYFSSNGLKIFIIYRVIFGVVILLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[1,1'-Binaphthalen]-8-ol
TRC-B387040-250MG 250 mg

[1,1'-Binaphthalen]-8-ol

Sign In for Pricing
View Details
Gsk3b, NT (Gsk3b, Glycogen synthase kinase-3 beta, Serine/threonine-protein kinase GSK3B) (MaxLight 490) discontinued
036332-ML490 100 µL

Gsk3b, NT (Gsk3b, Glycogen synthase kinase-3 beta, Serine/threonine-protein kinase GSK3B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Anti-DDX5 Rabbit pAb
GB112552-100 100 μL

Anti-DDX5 Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Pax8 shRNA (UAS) - Lentiviral mouse Pax8 shRNA (UAS, iRFP) plasmid
GTR15273436 1 Vial

Lentiviral mouse Pax8 shRNA (UAS) - Lentiviral mouse Pax8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal CD7 Antibody [DyLight 405]
NBP2-32097V 0.1 mL

Rabbit Polyclonal CD7 Antibody [DyLight 405]

Sign In for Pricing
View Details
CD30 (Tumor Necrosis Factor Receptor Superfamily Member 8, CD30L Receptor, Ki-1 Antigen, Lymphocyte Activation Antigen CD30, D1S166E, TNFRSF8) (MaxLight 550)
124597-ML550 100 µL

CD30 (Tumor Necrosis Factor Receptor Superfamily Member 8, CD30L Receptor, Ki-1 Antigen, Lymphocyte Activation Antigen CD30, D1S166E, TNFRSF8) (MaxLight 550)

Sign In for Pricing
View Details