Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP)

This Recombinant Prochlorococcus marinus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A8G4L8

Expression Region

1-266

Origin

Prochlorococcus marinus (strain MIT 9215)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEYLRFILYGLIQGLTEFLPISSTAHLKIISIFLGIDDPGSSLSATIQLGSVLAIVWYFR NDIFNFRGQSSKNILYYFLHERLLRSIFIGTIPIVLLGGSVKLFVPNFIDNVLRSNLSIA LVSIVMAFFMYLADSSKRGSIDIKNHNYSDSFLIGFFQALAIFPGVSRSGITISSALISG WERRDAAKFSFLLGMPAISLAAIVEFIFSFNEFFSIGFLPLLVGLMTTFLSSLLAIDFLL RYFSSNGLKIFIIYRVIFGVVILLNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CRELD1 Antibody [Janelia Fluor 549]
NBP2-98393JF549 0.1 mL

Rabbit Polyclonal CRELD1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
C-erbB-2/HER2 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated
bsm-33085M-BF555 100 µL

C-erbB-2/HER2 Monoclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PKC alpha/PRKCA Rabbit Polyclonal Antibody
orb234364 100 µg

PKC alpha/PRKCA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT Antibody
orb1253399 0.1 mg

MAPT Antibody

Sign In for Pricing
View Details
Rabbit Preptin ELISA Kit
EKE62462-01 96 Tests

Rabbit Preptin ELISA Kit

Sign In for Pricing
View Details
Rabbit Preptin ELISA Kit
EKE62462-02 5x 96 Tests

Rabbit Preptin ELISA Kit

Sign In for Pricing
View Details