Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliobacterium modesticaldum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Heliobacterium modesticaldum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

B0TC89

Expression Region

1-266

Origin

Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKDITLGQYVPLDSPVHRLDPRTKVIATLLFSIALFLLPTLRSVTLAGLPIIIAIVATR LPIHYILRGIKPLWIFIVFTLLVHLLSTPGETAVRLGPFAITWEGLRQGAMVSQRLIWLY AATSLLTLTTSPIALTDGLELLLSPGKRIGLPVHEFAMMTSIALRFIPTLIEETEKIMKA QSSRGADFDSGSLVARVKSLVPLMVPLLLSAFRRADELAMAMEARCYRGGEGRTRMRPLV MSGKDYAVTVAVSGVFILICLWKKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-PDZRN3
YF-PA27511 50 ug

anti-PDZRN3

Sign In for Pricing
View Details
Lentiviral human PTH1R shRNA (UAS) - Lentiviral human PTH1R shRNA (UAS) plasmid
GTR15152863 1 Vial

Lentiviral human PTH1R shRNA (UAS) - Lentiviral human PTH1R shRNA (UAS) plasmid

Sign In for Pricing
View Details
Lentiviral human TNFRSF9 sgRNA gene knockout kit - Lentiviral human TNFRSF9 sgRNA gene knockout kit (100)
GTR15368917 1 Vial

Lentiviral human TNFRSF9 sgRNA gene knockout kit - Lentiviral human TNFRSF9 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
ASNSD1 Polyclonal Antibody, Biotin Conjugated
A67869-050 50 µL

ASNSD1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF488A conjugate, 0.1mg/mL
BNC881887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Trans-1-Bromo-3- (trifluoromethyl) cyclobutane
PC1027038-01 100 mg

Trans-1-Bromo-3- (trifluoromethyl) cyclobutane

Sign In for Pricing
View Details