Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heliobacterium modesticaldum Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Heliobacterium modesticaldum Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

B0TC89

Expression Region

1-266

Origin

Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKDITLGQYVPLDSPVHRLDPRTKVIATLLFSIALFLLPTLRSVTLAGLPIIIAIVATR LPIHYILRGIKPLWIFIVFTLLVHLLSTPGETAVRLGPFAITWEGLRQGAMVSQRLIWLY AATSLLTLTTSPIALTDGLELLLSPGKRIGLPVHEFAMMTSIALRFIPTLIEETEKIMKA QSSRGADFDSGSLVARVKSLVPLMVPLLLSAFRRADELAMAMEARCYRGGEGRTRMRPLV MSGKDYAVTVAVSGVFILICLWKKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-1,4-trans-DACH*HCl
sc-293629 1 g

Boc-1,4-trans-DACH*HCl

Sign In for Pricing
View Details
DFNB94 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV723040 1.0 µg DNA

DFNB94 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Anti-IRGQ Antibody Picoband
MBS1759504-01 0.01 mg

Anti-IRGQ Antibody Picoband

Sign In for Pricing
View Details
Anti-IRGQ Antibody Picoband
MBS1759504-02 0.1 mg (Carrier Free)

Anti-IRGQ Antibody Picoband

Sign In for Pricing
View Details
Anti-IRGQ Antibody Picoband
MBS1759504-03 0.1 mg

Anti-IRGQ Antibody Picoband

Sign In for Pricing
View Details
Anti-IRGQ Antibody Picoband
MBS1759504-04 0.1 mg (Cy3)

Anti-IRGQ Antibody Picoband

Sign In for Pricing
View Details