Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alkaline ceramidase 1 (acer1)

This Recombinant Danio rerio Alkaline ceramidase 1 (acer1) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Alkaline ceramidase 1, AlkCDase 1, Alkaline CDase 1, EC= 3.5.1.23, Acylsphingosine deacylase 3, N-acylsphingosine amidohydrolase 3

UniProt

Q568I2

Expression Region

1-266

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVFSYESSEVDWCEDNYKHSENVVEYFNTMSSFIFFVISPIMLYLLHPYAKERNLAVH LVWIMMVFVGIFSMYFHMTLSFMGQMLDELSILWVLAIGYSLWFPRKHFPSFVKDRTSFA RLVLTITIISTLSSFVKPTANAYALNCFAIHILYSLFVELKSCTDERVLRLAWASIGLWV LAISCWISDRFGCSFWQKLDFCYLHGIWHILIVMATAYASTLIAYLDASQEIPYSLPDLQ YWPRNNWAIGLPYIVLKGTNTTRKTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-01 0.1 mL (Biotin)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-02 0.1 mL (AF350)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-03 0.1 mL (AF405)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-04 0.1 mL (AF488)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-05 0.1 mL (AF555)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
MAN2B1 Polyclonal Conjugated Antibody
MBS9442946-06 0.1 mL (AF594)

MAN2B1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details