Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Alkaline ceramidase 1 (acer1)

This Recombinant Danio rerio Alkaline ceramidase 1 (acer1) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Alkaline ceramidase 1, AlkCDase 1, Alkaline CDase 1, EC= 3.5.1.23, Acylsphingosine deacylase 3, N-acylsphingosine amidohydrolase 3

UniProt

Q568I2

Expression Region

1-266

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVFSYESSEVDWCEDNYKHSENVVEYFNTMSSFIFFVISPIMLYLLHPYAKERNLAVH LVWIMMVFVGIFSMYFHMTLSFMGQMLDELSILWVLAIGYSLWFPRKHFPSFVKDRTSFA RLVLTITIISTLSSFVKPTANAYALNCFAIHILYSLFVELKSCTDERVLRLAWASIGLWV LAISCWISDRFGCSFWQKLDFCYLHGIWHILIVMATAYASTLIAYLDASQEIPYSLPDLQ YWPRNNWAIGLPYIVLKGTNTTRKTC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A2 Antibody - C-terminal region : Biotin (ARP65709_P050-Biotin)
ARP65709_P050-Biotin 100 µL

SLC25A2 Antibody - C-terminal region : Biotin (ARP65709_P050-Biotin)

Sign In for Pricing
View Details
WDR64 (NM_144625) Human Tagged ORF Clone
RC212104 10 µg

WDR64 (NM_144625) Human Tagged ORF Clone

Sign In for Pricing
View Details
F/IMO127-SA-PHOLUMB-150x150/1-B Marine & IMO Signs & Labels (Adhesive)
195385 1 Pack (1 Panel (s) x 1 Pack)

F/IMO127-SA-PHOLUMB-150x150/1-B Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details
RPS10P24 CRISPR Knock Out 293T Cell Line (Human)
42029141 1x 10^6 Cells / 1.0 mL

RPS10P24 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
β-1,3-Gal-TL Antibody
C14717-01 50 μL

β-1,3-Gal-TL Antibody

Sign In for Pricing
View Details
β-1,3-Gal-TL Antibody
C14717-02 100 µL

β-1,3-Gal-TL Antibody

Sign In for Pricing
View Details