Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrobaculum aerophilum Undecaprenyl-diphosphatase (uppP)

This Recombinant Pyrobaculum aerophilum Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Undecaprenyl pyrophosphate phosphatase

UniProt

Q8ZYX0

Expression Region

1-266

Origin

Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLGVAAILGVVQGISEWLPISSKTQIMLVSIWLLNASPEYAYSLGLFLEAASVLAALIY FRGVYLKALRGFVGDAEGRRWLVYILVTTLVTAVVGLPLYYVARKWLVVGHSAGFLMIVL GLAVVLNAVFLQRARFSAGLKAFDNMSLRDMAIVGIAQAVSVLPGLSRSGATVTALLLLG YKPEEAFRASFVLVPVAGLGATALAYLSEGGAVATAEALLAMAIGIVISIITIKALLEFA KSKHVVLVNVVIGLLAIAGGLLRIIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL
BNC400149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-500 1x 500 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL
BNC400262-500 1x 500 µL

Human Lambda Light Chain (HP6054), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details