Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorbose permease IIC component (sorA)

This Recombinant Sorbose permease IIC component (sorA) spans the amino acid sequence from region 1-266.

Product Specifications

Product Name Alternative

Sorbose permease IIC component, EIIC-Sor, PTS system sorbose-specific EIIC component

UniProt

P37082

Expression Region

1-266

Origin

Klebsiella pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEISTLQIIAIFIFSCIAGMGSVLDEFQTHRPLIACTVIGLILGDLKTGVMLGGTLELIA LGWMNVGAAQSPDSALASIISAILVIVGHQSIAIGIAIALPVAAAGQVLTVFARTITVVF QHAADKAAEEARFRTIDLLHVSALGVQGLRVAIPALVVSLFVSADMVSSMLSAIPEFVTR GLQIAGGFIVVVGYAMVLRMMGVKYLMPFFFLGFLAGGYLDFSLLAFGGVGVIIALIYIQ LNPQWRKAEPAASTAPSAPALDQLDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin-Conjugating Enzyme E2 S/UBE2S (N-GST)
C289-10ug 10 µg

Recombinant Human Ubiquitin-Conjugating Enzyme E2 S/UBE2S (N-GST)

Sign In for Pricing
View Details
Human Ras-related protein Rab-37 ELISA Kit
MBS289008-01 48 Well

Human Ras-related protein Rab-37 ELISA Kit

Sign In for Pricing
View Details
Human Ras-related protein Rab-37 ELISA Kit
MBS289008-02 96 Well

Human Ras-related protein Rab-37 ELISA Kit

Sign In for Pricing
View Details
Human Ras-related protein Rab-37 ELISA Kit
MBS289008-03 5x 96 Well

Human Ras-related protein Rab-37 ELISA Kit

Sign In for Pricing
View Details
Human Ras-related protein Rab-37 ELISA Kit
MBS289008-04 10x 96 Well

Human Ras-related protein Rab-37 ELISA Kit

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)
MBS2054742-01 0.1 mL

APC-Linked Polyclonal Antibody to Activating Transcription Factor 7 (ATF7)

Sign In for Pricing
View Details