Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus suis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A4W334

Expression Region

1-267

Origin

Streptococcus suis (strain 98HAH33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIEKRLNMDPIAIKLGPLEIRWYAICILLGLILGVYLATKEGPRKKIRQDDILDFILI AFPLSILGARIYYVAFSWSEYKDNILSIFAIWNGGIAIYGGLITGAIVLYFFTQYRFINT LDFLDIVAPSVMIAQAIGRWGNFFNQEAYGKAVESLNYLPAFIRDQMYIDGAYRQPTFLF ESLWNLLGFGLVCVLRRRPKFLKQGEITAFYLVWYGCGRLLIEGLRTDSLMFLGIRVSQW LSGVLILVGIIMVVLRRRKSSIPFYQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC691984 3'UTR GFP Stable Cell Line
TU262463 1.0 mL

LOC691984 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
USP28 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb894102 100 µL

USP28 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
DSG4 sgRNA CRISPR Lentivector set (Human)
K0634601 3x 1.0 µg

DSG4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - AcalephFluor790
CSA4240-01 100 µL

Mouse Anti-Monkey IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - AcalephFluor790
CSA4240-02 500 μL

Mouse Anti-Monkey IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details
Mouse Anti-Monkey IgG (H&L) - AcalephFluor790
CSA4240-03 1 mL

Mouse Anti-Monkey IgG (H&L) - AcalephFluor790

Sign In for Pricing
View Details