Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus suis Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Streptococcus suis Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A4VWT2

Expression Region

1-267

Origin

Streptococcus suis (strain 05ZYH33)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTIEKRLNMDPIAIKLGPLEIRWYAICILLGLILGVYLATKEGPRKKIRQDDILDFILI AFPLSILGARIYYVAFSWSEYKDNILSIFAIWNGGIAIYGGLITGAIVLYFFTQYRFINT LDFLDIVAPSVMIAQAIGRWGNFFNQEAYGKAVESLNYLPAFIRDQMYIDGAYRQPTFLF ESLWNLLGFGLVCVLRRRPKFLKQGEITAFYLVWYGCGRLLIEGLRTDSLMFLGIRVSQW LSGVLILVGIIMVVLRRRKSSIPFYQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG2B Isotype Control (Clone 20116)
MAB004 500 µg

Mouse IgG2B Isotype Control (Clone 20116)

Sign In for Pricing
View Details
Matn1 3'UTR Lenti-reporter-Luc Vector
28147086 1.0 µg

Matn1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PNPO Antibody (C-term)
E45R09415G-4 50 µL

PNPO Antibody (C-term)

Sign In for Pricing
View Details
Phospho-MCSF Receptor (Tyr708) Antibody
AF4394-01 100 µL

Phospho-MCSF Receptor (Tyr708) Antibody

Sign In for Pricing
View Details
Phospho-MCSF Receptor (Tyr708) Antibody
AF4394-02 200 µL

Phospho-MCSF Receptor (Tyr708) Antibody

Sign In for Pricing
View Details
SLC48A1 siRNA (Human)
CRJ0804-01 15 nmol

SLC48A1 siRNA (Human)

Sign In for Pricing
View Details