Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP)

This Recombinant Campylobacter jejuni subsp. doylei Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A7H1R9

Expression Region

1-267

Origin

Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGNLYALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLSVGFFPTGVIGFFVAKYLNALFNGWVVVGMLIFGGVMFILIEFAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUZ12 Rabbit mAb
E45R12413N-100 100 µL

SUZ12 Rabbit mAb

Sign In for Pricing
View Details
DGKI Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-14299R-BF680-TR 20 µL

DGKI Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Retinoblastoma (Phospho-Ser249) Antibody
MBS9502790-01 0.05 mL

Retinoblastoma (Phospho-Ser249) Antibody

Sign In for Pricing
View Details
Retinoblastoma (Phospho-Ser249) Antibody
MBS9502790-02 0.1 mL

Retinoblastoma (Phospho-Ser249) Antibody

Sign In for Pricing
View Details
Retinoblastoma (Phospho-Ser249) Antibody
MBS9502790-03 5x 0.1 mL

Retinoblastoma (Phospho-Ser249) Antibody

Sign In for Pricing
View Details
ATOH1 Rabbit Polyclonal Antibody
TA302151 400 µL

ATOH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details