Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A8FK06

Expression Region

1-267

Origin

Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAAGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf64 Antibody
orb33739-01 50 µg

C17orf64 Antibody

Sign In for Pricing
View Details
C17orf64 Antibody
orb33739-02 100 µg

C17orf64 Antibody

Sign In for Pricing
View Details
Naip2 Protein Vector (Mouse) (pPM-C-His)
PV204033 500 ng

Naip2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein C20orf85 (C-His)
32-10392-500 500 µg

Recombinant Human Uncharacterized protein C20orf85 (C-His)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Recombination protein RecR (recR)
MBS1247525-01 0.02 mg (E-Coli)

Recombinant Francisella tularensis subsp. mediasiatica Recombination protein RecR (recR)

Sign In for Pricing
View Details
Recombinant Francisella tularensis subsp. mediasiatica Recombination protein RecR (recR)
MBS1247525-02 0.1 mg (E-Coli)

Recombinant Francisella tularensis subsp. mediasiatica Recombination protein RecR (recR)

Sign In for Pricing
View Details