Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A8FK06

Expression Region

1-267

Origin

Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAAGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD164/Endolyn Protein (His Tag)
PKSH030861 50 µg

Recombinant Human CD164/Endolyn Protein (His Tag)

Sign In for Pricing
View Details
Teashirt homolog 2 (TSHZ2) Human qPCR Primer Pair (NM_173485)
HP218309 200 Reactions

Teashirt homolog 2 (TSHZ2) Human qPCR Primer Pair (NM_173485)

Sign In for Pricing
View Details
Spark NIR™ 685 Mouse IgG2a, κ Isotype Ctrl
GT17031 25 Tests

Spark NIR™ 685 Mouse IgG2a, κ Isotype Ctrl

Sign In for Pricing
View Details
MEK1
323571 100 µL

MEK1

Sign In for Pricing
View Details
HS747E2A (C22orf31) Human shRNA Plasmid Kit (Locus ID 25770)
TR306951 1 Kit

HS747E2A (C22orf31) Human shRNA Plasmid Kit (Locus ID 25770)

Sign In for Pricing
View Details
Neuropeptide Y Receptor, Type 1 (NPY 1R) discontinued
N2176-50H 100 µL

Neuropeptide Y Receptor, Type 1 (NPY 1R) discontinued

Sign In for Pricing
View Details