Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP)

This Recombinant Campylobacter jejuni subsp. jejuni serotype O:6 Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

A8FK06

Expression Region

1-267

Origin

Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENLNALILGIIEGLTEFLPVSSTGHMILGTTILGIDIDEFWKSFLIIIQLGSILAVIFV FWRKLFQGLDIWLKLAAGFFPTGVIGLFVAKYLNALFNGWVVVGMLIFGGVVFILIELAH KNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGGLLLGFNRKVAAEFSFLL AIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFVVAVLVIKFFLKFISKFDFIPFG IYRIILGFVFFYLYYSGILNAGSEFKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Acetobutylicum CA_C3446 Protein (aa 1-302)
VAng-Lsx7500-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Acetobutylicum CA_C3446 Protein (aa 1-302)

Sign In for Pricing
View Details
Rabbit Polyclonal BNIP3 Antibody [Alexa Fluor 594]
NBP1-77683AF594 0.1 mL

Rabbit Polyclonal BNIP3 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
AAV-U6gRNA1-U6gRNA2-TnT-Cre Plasmid
PVT10895 2 µg

AAV-U6gRNA1-U6gRNA2-TnT-Cre Plasmid

Sign In for Pricing
View Details
GPR18 Antibody (Biotin)
orb355104-01 50 µg

GPR18 Antibody (Biotin)

Sign In for Pricing
View Details
GPR18 Antibody (Biotin)
orb355104-02 100 µg

GPR18 Antibody (Biotin)

Sign In for Pricing
View Details
Sheep Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) ELISA Kit
OM621348 96 Strip Well

Sheep Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) ELISA Kit

Sign In for Pricing
View Details