Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Haemophilus parasuis serovar 5 Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B8F8N6

Expression Region

1-267

Origin

Haemophilus parasuis serovar 5 (strain SH0165)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEQFLTFPNIDPVALQLGPVSLHWYGIMYLLGFGFAYWLGTKRAKNSNGVWSVEQVDQL LFNGFWGVVLGGRIGDVFFYSFDRFLQDPLYLFRIWEGGMSFHGGLLGVIVAMLWTSRRQ NRNFWQTADFIAPLIPFGLGLGRIGNFINDELWGRVTDVPWAIMFPSGGYLPRHPSQLYE AVLEGLVLFFILNGYIRKPRPTGSVAGLFLVGYGVFRFIVEYFREFDPNVNTAADLITRG QLLSLPMIIGGLVIMVVAYYRHRLSND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-100 1x 100 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-100 1x 100 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-100 1x 100 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF594 conjugate, 0.1mg/mL
BNC942558-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL
BNC040385-500 1x 500 µL

CD3e (Rabbit PAb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details