Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gemmatimonas aurantiaca Undecaprenyl-diphosphatase (uppP)

This Recombinant Gemmatimonas aurantiaca Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

C1A8L5

Expression Region

1-267

Origin

Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVWQAIVLGIVQGLTEPLPVSSSAHLALTPYFLGWSDPGLAFDVALHFGTLLALIWYFR REWLEMIASAWRIARTRRVETVHDRRVLYLIAATIPGGIGGLLLNDLAETTFRSPVVIAT SLIVMGILLWAVDRWSARARVLEEVTLRDAIIVGCAQVLALVPGVSRSGSTMTAGRLLKL DRPSVARFSFLMSMPITLAAVIVKMPDAVREHGASLPLLAGVAAAAVSSWFAISVLLRYV ARHSFGVFAVYRVLLGIVVFATLASRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CT47A7 (NM_001080140) Human Over-expression Lysate
LC421596 20 µg

CT47A7 (NM_001080140) Human Over-expression Lysate

Sign In for Pricing
View Details
PTH / Parathyroid Hormone (N-Terminal) (3H9), CF568 conjugate, 0.1mg/mL
BNC680242-500 1x 500 µL

PTH / Parathyroid Hormone (N-Terminal) (3H9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RPL39L activation kit by CRISPRa
GA114608 1 Kit

Human RPL39L activation kit by CRISPRa

Sign In for Pricing
View Details
N-Boc-γ-aminobutyric Acid
TRC-N656140-250MG 250 mg

N-Boc-γ-aminobutyric Acid

Sign In for Pricing
View Details
Prss34 Mouse Gene Knockout Kit (CRISPR)
KN514035 1 Kit

Prss34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details