Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 3 (Acer3)

This Recombinant Mouse Alkaline ceramidase 3 (Acer3) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Alkaline ceramidase 3, AlkCDase 3, Alkaline CDase 3, EC= 3.5.1.-, Alkaline phytoceramidase, aPHC

UniProt

Q9D099

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLE KRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYH LLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLT VFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRT LYLRYRPKVKFLFGIWPAVMFEPQRKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5orf24 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2508627 100 µL

C5orf24 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
F8a1 3'UTR Luciferase Stable Cell Line
TU204195 1.0 mL

F8a1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MYT1L (Myelin Transcription Factor 1-like, NZF1) (MaxLight 550)
MBS6218178-01 0.1 mL

MYT1L (Myelin Transcription Factor 1-like, NZF1) (MaxLight 550)

Sign In for Pricing
View Details
MYT1L (Myelin Transcription Factor 1-like, NZF1) (MaxLight 550)
MBS6218178-02 5x 0.1 mL

MYT1L (Myelin Transcription Factor 1-like, NZF1) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Sulfate adenylyltransferase subunit 2 (cysD)
MBS1058164-01 0.02 mg (E-Coli)

Recombinant Geobacter sp. Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Sulfate adenylyltransferase subunit 2 (cysD)
MBS1058164-02 0.02 mg (Yeast)

Recombinant Geobacter sp. Sulfate adenylyltransferase subunit 2 (cysD)

Sign In for Pricing
View Details