Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 3 (Acer3)

This Recombinant Mouse Alkaline ceramidase 3 (Acer3) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Alkaline ceramidase 3, AlkCDase 3, Alkaline CDase 3, EC= 3.5.1.-, Alkaline phytoceramidase, aPHC

UniProt

Q9D099

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLE KRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYH LLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLT VFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRT LYLRYRPKVKFLFGIWPAVMFEPQRKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRI Antibody
DF14648-01 100 µL

SRI Antibody

Sign In for Pricing
View Details
SRI Antibody
DF14648-02 200 µL

SRI Antibody

Sign In for Pricing
View Details
HTRA1 Antibody
orb619983 100 µL

HTRA1 Antibody

Sign In for Pricing
View Details
Rotavirus A PCR Kit
VT013050T 50 Reactions

Rotavirus A PCR Kit

Sign In for Pricing
View Details
EphA4 Protein Vector (Rat) (pPM-C-His)
PV266341 500 ng

EphA4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Hsa-miR-4640-5p agomir
HY-R01185A-01 5 nmol

Hsa-miR-4640-5p agomir

Sign In for Pricing
View Details