Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Alkaline ceramidase 3 (Acer3)

This Recombinant Mouse Alkaline ceramidase 3 (Acer3) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Alkaline ceramidase 3, AlkCDase 3, Alkaline CDase 3, EC= 3.5.1.-, Alkaline phytoceramidase, aPHC

UniProt

Q9D099

Expression Region

1-267

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPAVDRKGYWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLE KRYIAAYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKTKSSINYH LLFTLFLYSLTVTTIYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLT VFLLGFLLWNIDNIFCDSLRNFRKRVPPVLGVTTQFHAWWHILTGLGSYLHILFSLYTRT LYLRYRPKVKFLFGIWPAVMFEPQRKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPBP (Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, Small-inducible Cytokine B7, CTAP3, CXCL7, SCYB7, TGB1, THBGB1) (MaxLight 550)
131649-ML550 100 µL

PPBP (Platelet Basic Protein, PBP, C-X-C Motif Chemokine 7, Leukocyte-derived Growth Factor, LDGF, Macrophage-derived Growth Factor, MDGF, Small-inducible Cytokine B7, CTAP3, CXCL7, SCYB7, TGB1, THBGB1) (MaxLight 550)

Sign In for Pricing
View Details
DOC2B Rabbit Polyclonal Antibody (BF488)
orb2515052 100 µL

DOC2B Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Recombinant Mouse Phosphomannomutase 1 (Pmm1)
MBS1177635-01 0.02 mg (E-Coli)

Recombinant Mouse Phosphomannomutase 1 (Pmm1)

Sign In for Pricing
View Details
Recombinant Mouse Phosphomannomutase 1 (Pmm1)
MBS1177635-02 0.02 mg (Yeast)

Recombinant Mouse Phosphomannomutase 1 (Pmm1)

Sign In for Pricing
View Details
Recombinant Mouse Phosphomannomutase 1 (Pmm1)
MBS1177635-03 0.1 mg (E-Coli)

Recombinant Mouse Phosphomannomutase 1 (Pmm1)

Sign In for Pricing
View Details
Recombinant Mouse Phosphomannomutase 1 (Pmm1)
MBS1177635-04 0.1 mg (Yeast)

Recombinant Mouse Phosphomannomutase 1 (Pmm1)

Sign In for Pricing
View Details