Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0413 (MJ0413)

This Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0413 (MJ0413) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein MJ0413

UniProt

Q57856

Expression Region

1-267

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNHKKGISVKINTKELVLKISLPALAVVIWELLAIYINNPVILPRVEAVINVLIHPFQG ILGTGSLIDNTIISIKRVISGFLLASAVAIPLGILMGYYRTVNSLCDTLIELLRPIPPLA WVPLSLAWFGLGEMSMIFIIFIGAFFPILINTISGVKGVPTPLIEAALTLGAKGRDILIK VVIPASSPSILTGLRVGAGIAWMCVVAAEMLPSSNAGLGYLIMYAYSLSRMDVVIACMII IGLIGLVLDRGLRYIEDKYFVWRKMMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MRPL50 shRNA (UAS) - Lentiviral human MRPL50 shRNA (UAS, GFP) plasmid
GTR15348385 1 Vial

Lentiviral human MRPL50 shRNA (UAS) - Lentiviral human MRPL50 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Human Immunoglobulin A2, IgA2 ELISA KIT
E4195hu-01 48 Well

Human Immunoglobulin A2, IgA2 ELISA KIT

Sign In for Pricing
View Details
Human Immunoglobulin A2, IgA2 ELISA KIT
E4195hu-02 96 Well

Human Immunoglobulin A2, IgA2 ELISA KIT

Sign In for Pricing
View Details
Human Immunoglobulin A2, IgA2 ELISA KIT
E4195hu-03 5x 96 Tests

Human Immunoglobulin A2, IgA2 ELISA KIT

Sign In for Pricing
View Details
Human Immunoglobulin A2, IgA2 ELISA KIT
E4195hu-04 10x 96 Tests

Human Immunoglobulin A2, IgA2 ELISA KIT

Sign In for Pricing
View Details
Anti-CRHR1 antibody
STJ110707 100 µl

Anti-CRHR1 antibody

Sign In for Pricing
View Details