Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Silicibacter pomeroyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q5LLZ3

Expression Region

1-267

Origin

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQGQVIDVAVHVGTLGAVVLYFW RDVRDGLAGLPRALTGRLDTPGARLAMGLIVATIPTVLAGAALHFTGLSDALRSITVIGW TMLLFGLLLWWADRTGAQVKEATDWSLRDALILGLWQAVALIPGTSRSGITITGARAMGY TRSDGARISMLMSIPTIIASGVLLGADVAVTSDAQAARDGAIAAAFAFVSALLALSLMMR LLRSVSFTPYVIYRLALGLVLLGIAYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IP3R-III Lentiviral Activation Particles (h2)
sc-402138-LAC-2 200 µL

IP3R-III Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Human Proliferating cell nuclear antigen (PCNA)
RPC21792-01 20 µg

Recombinant Human Proliferating cell nuclear antigen (PCNA)

Sign In for Pricing
View Details
Recombinant Human Proliferating cell nuclear antigen (PCNA)
RPC21792-02 100 µg

Recombinant Human Proliferating cell nuclear antigen (PCNA)

Sign In for Pricing
View Details
Recombinant Human Proliferating cell nuclear antigen (PCNA)
RPC21792-03 1 mg

Recombinant Human Proliferating cell nuclear antigen (PCNA)

Sign In for Pricing
View Details
BAIAP2 Human Gene Knockout Kit (CRISPR)
KN404233 1 Kit

BAIAP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pig MT-ND1/NADH-ubiquinone oxidoreductase chain 1 ELISA Kit
MBS2904609-01 48 Well

Pig MT-ND1/NADH-ubiquinone oxidoreductase chain 1 ELISA Kit

Sign In for Pricing
View Details