Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Silicibacter pomeroyi Undecaprenyl-diphosphatase (uppP)

This Recombinant Silicibacter pomeroyi Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q5LLZ3

Expression Region

1-267

Origin

Silicibacter pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFHLILVALIQGITEFLPVSSSGHLILLPALTGLEDQGQVIDVAVHVGTLGAVVLYFW RDVRDGLAGLPRALTGRLDTPGARLAMGLIVATIPTVLAGAALHFTGLSDALRSITVIGW TMLLFGLLLWWADRTGAQVKEATDWSLRDALILGLWQAVALIPGTSRSGITITGARAMGY TRSDGARISMLMSIPTIIASGVLLGADVAVTSDAQAARDGAIAAAFAFVSALLALSLMMR LLRSVSFTPYVIYRLALGLVLLGIAYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDCD2 Antibody, FITC conjugated
A63511-100UG 100 µg

NUDCD2 Antibody, FITC conjugated

Sign In for Pricing
View Details
SLC29A4 Rabbit Polyclonal Antibody
TA365021 100 µL

SLC29A4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF2AK4/GCN2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2434960 100 µL

EIF2AK4/GCN2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
3-Indazolinone 97%
I00780-01 1 g

3-Indazolinone 97%

Sign In for Pricing
View Details
3-Indazolinone 97%
I00780-02 5 g

3-Indazolinone 97%

Sign In for Pricing
View Details
Recombinant human Cysteine Conjugate beta -Lyase/CCBL1 protein
ATGP3102-100 100 µg

Recombinant human Cysteine Conjugate beta -Lyase/CCBL1 protein

Sign In for Pricing
View Details