Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit C (mtrC)

This Recombinant Methanosarcina acetivorans Tetrahydromethanopterin S-methyltransferase subunit C (mtrC) spans the amino acid sequence from region 1-267.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit C, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit C

UniProt

Q8TU01

Expression Region

1-267

Origin

Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAGGAGGEAKGGFPPQTIMAIGAIGGLAGIYLGNFMPAQFSFFGGLGAICAMVWGADAV RRVASYGLGTGVPSIGMISLGMGIVAALFGLSVGGIAGPIVSFIAAAIIGAVIGVLANKV IGMGIPIMEQAMVEIAGAGTLVIIGLSVVIAGTFDYAEVVEYVVANGYIALIFIIGGMGI LHPFNANLGPDEKQDRTLSVAVEKAAIALIITGFASSLHEGLMAAGLNIAVGVIIWAWAF MKYYGYVKRDSYAVVGTGLLPSAEELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTUD4 (NM_001102653) Human Untagged Clone
SC316977 10 µg

OTUD4 (NM_001102653) Human Untagged Clone

Sign In for Pricing
View Details
Anti-Lamin B2/LMNB2 Antibody Picoband®, iFluor647 Conjugate
PA1636-iFluor647 100 µg

Anti-Lamin B2/LMNB2 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
METTL22 Antibody - C-terminal region
ARP48894_P050-25UL 25 µL

METTL22 Antibody - C-terminal region

Sign In for Pricing
View Details
TRPC3 HDR Plasmid (m2)
sc-423514-HDR-2 20 µg

TRPC3 HDR Plasmid (m2)

Sign In for Pricing
View Details
HOXC11 Peptide
orb2020688 100 µg

HOXC11 Peptide

Sign In for Pricing
View Details
LPA Rabbit Polyclonal Antibody
orb326333 100 µL

LPA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details