Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pyrobaculum islandicum Undecaprenyl-diphosphatase (uppP)

This Recombinant Pyrobaculum islandicum Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Undecaprenyl pyrophosphate phosphatase

UniProt

A1RQS3

Expression Region

1-268

Origin

Pyrobaculum islandicum (strain DSM 4184 / JCM 9189)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLTAIVLGVVQGVSEWLPISSKTQVMFVSQLLLSATPELAYSLGLFLEAASVLAALIY FRLVYLKILRGFLGDAEGRKWLTYVIVTTAATGAVGIPLYMAAKRYLLLGASAGWLMVVL GVAVIFNAVLLQRARSVAGLKTFDDMTLGHMALVGLAQALSVLPGISRSGITTTTLLLLG YRPDEAFKSSFVLVPIAGLGATALAYLSEGGAVATPEVITAMLIGLVVSLVTIKALLEFA KSKHVTLVNIVVGTLAIAGGITRILLSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), CF647 conjugate, 0.1mg/mL
BNC470906-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL
BNC881462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T-Cell Leukemia Marker) (CD7/3737), CF488A conjugate, 0.1mg/mL
BNC882056-100 1x 100 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF740 conjugate, 0.1mg/mL
BNC741983-500 1x 500 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details