Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Rhizobium sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

C3MCT9

Expression Region

1-268

Origin

Rhizobium sp. (strain NGR234)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL VYFQKLLSIALALPTSVKARRFVFSVLIAFLPAALIGAAAHGFIKAVLFETPMLICVVLI VGGVILYAIDRLPLQPRYTDVFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTD KRSAAEFSFFLAMPTMLGAFTLDLYKNRDALSFDDIGVIAIGFIAAFVAGIVVVRSLLDF VSHRGFTPFAIWRIVVGTAGLVGLWLVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (MSN/493), CF568 conjugate, 0.1mg/mL
BNC680493-100 1x 100 µL

Moesin (MSN/493), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (HH1/957), CF640R conjugate, 0.1mg/mL
BNC400957-500 1x 500 µL

Histone H1 (HH1/957), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (SPN/839), CF568 conjugate, 0.1mg/mL
BNC680839-500 1x 500 µL

CD43 (SPN/839), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF594 conjugate, 0.1mg/mL
BNC941731-500 1x 500 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details