Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesorhizobium sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Mesorhizobium sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

Q11CA6

Expression Region

1-268

Origin

Mesorhizobium sp. (strain BNC1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQTIAQALMLGVLEGFTEFIPVSSTGHILLAGHFLGFQSTGKAFEILIQLGAILAVLS VYAGRLWKMLIELPHEPATRRFVLGILIAFLPAAIIGVVAYQIIKTVLFETPLLICTMLI LGGIVLLWVDRWAKKPLYRDITQFPLSVYLKIGLFQCLSMIPGTSRSGSTIVGALLLGVD KRAAAEFSFFLAMPTMAGAFAYDLYKNYHLLTAADLQIIGVGFIAAFVAAVLVVRSLLDF VSRRGYALFGWWRIFIGVLGLIGVLVLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
BNC402216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-100 1x 100 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-100 1x 100 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF640R conjugate, 0.1mg/mL
BNC400705-100 1x 100 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details