Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pseudomonas putida Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q88CN8

Expression Region

1-268

Origin

Pseudomonas putida (strain KT2440)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRLNRFDPTWNREKLSDLVFWL SMGVIVGGRLGYVLFYDLHAYLANPTLIFEVWKGGMSFHGGFIGVMLAALWFGKRNNKSF FELMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMIFPPFSDPAQLPRHPSQLYQF ALEGVALFVILWLFSRKPRPTMAVSGMFSLCYGIFRFAVEFVRVPDAQLGYIAFGWLTQG QLLCIPMIVGGLVLIWWAYNRKPTAKPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Septin 4 (SEPT-4 / SEPT4) ELISA
KBH15903 1x 96 Well

GENLISA Human Septin 4 (SEPT-4 / SEPT4) ELISA

Sign In for Pricing
View Details
CCDC33 (H-2) Alexa Fluor® 546
sc-390852 AF546 200 µg/mL

CCDC33 (H-2) Alexa Fluor® 546

Sign In for Pricing
View Details
FAM160B2 Rabbit pAb
A18836-01 20 µL

FAM160B2 Rabbit pAb

Sign In for Pricing
View Details
FAM160B2 Rabbit pAb
A18836-02 100 μL

FAM160B2 Rabbit pAb

Sign In for Pricing
View Details
FAM160B2 Rabbit pAb
A18836-03 500 μL

FAM160B2 Rabbit pAb

Sign In for Pricing
View Details
FAM160B2 Rabbit pAb
A18836-04 1000 μL

FAM160B2 Rabbit pAb

Sign In for Pricing
View Details