Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Pseudomonas putida Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q88CN8

Expression Region

1-268

Origin

Pseudomonas putida (strain KT2440)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPYPQIDPVALAIGPLKIHWYGLMYLIGIGGAWLLASRRLNRFDPTWNREKLSDLVFWL SMGVIVGGRLGYVLFYDLHAYLANPTLIFEVWKGGMSFHGGFIGVMLAALWFGKRNNKSF FELMDFVAPLVPIGLGAGRIGNFINAELWGKPTDVPWAMIFPPFSDPAQLPRHPSQLYQF ALEGVALFVILWLFSRKPRPTMAVSGMFSLCYGIFRFAVEFVRVPDAQLGYIAFGWLTQG QLLCIPMIVGGLVLIWWAYNRKPTAKPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP300, Phosphorylated (Ser89) (Histone Acetyltransferase p300, E1A-associated Protein p300, p300 HAT) (MaxLight 650)
MBS6491622-01 0.1 mL

EP300, Phosphorylated (Ser89) (Histone Acetyltransferase p300, E1A-associated Protein p300, p300 HAT) (MaxLight 650)

Sign In for Pricing
View Details
EP300, Phosphorylated (Ser89) (Histone Acetyltransferase p300, E1A-associated Protein p300, p300 HAT) (MaxLight 650)
MBS6491622-02 5x 0.1 mL

EP300, Phosphorylated (Ser89) (Histone Acetyltransferase p300, E1A-associated Protein p300, p300 HAT) (MaxLight 650)

Sign In for Pricing
View Details
Lentiviral mouse Spata45 shRNA (UAS) - Lentiviral mouse Spata45 shRNA (UAS) (25)
GTR15263753 1 Vial

Lentiviral mouse Spata45 shRNA (UAS) - Lentiviral mouse Spata45 shRNA (UAS) (25)

Sign In for Pricing
View Details
RFC5 (F-9) HRP
sc-376528 HRP 200 µg/mL

RFC5 (F-9) HRP

Sign In for Pricing
View Details
SNRPA1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62463R-BF405 100 µL

SNRPA1 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
C Reactive Protein Antibody (YA939, Mouse)
HY-P81262-01 10 µL

C Reactive Protein Antibody (YA939, Mouse)

Sign In for Pricing
View Details