Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zinc transporter ZupT (zupT)

This Recombinant Zinc transporter ZupT (zupT) spans the amino acid sequence from region 1-268.

Product Specifications

Product Name Alternative

Zinc transporter ZupT

UniProt

Q8FTK0

Expression Region

1-268

Origin

Corynebacterium efficiens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDWSNIIFAFSLTLFAGLATGVGGVIAVARKAPGERFLAGSLGFSVGVMLFVSFVEILPK AVEELTGVWGERGGNWAATGAFFAGIALIAVIDRLVPTAINPHEPSTVGGAVEGYERRSR MMRAGVLTAIAISIHNFPEGFATFVAGLTDPRIAIPVAVAIAIHNIPEGIAVAVPIREAT GSRGKALKWATLSGLAEPAGAVVGFILLMPFLGPEAMGLSFAAVAGIMVFISLDELLPTA ISSGRHHTAIYGLVGGMAVMAVSLLLFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC16 Protein Vector (Mouse) (pPM-C-His)
PV163749 500 ng

CDC16 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
AChR beta (Acetylcholine Receptor Subunit beta) discontinued
227384 100 µg

AChR beta (Acetylcholine Receptor Subunit beta) discontinued

Sign In for Pricing
View Details
Cdh17 Rat shRNA Plasmid (Locus ID 117048)
TR712306 1 Kit

Cdh17 Rat shRNA Plasmid (Locus ID 117048)

Sign In for Pricing
View Details
MRPL36 Rabbit pAb
MBS9148668-01 0.02 mL

MRPL36 Rabbit pAb

Sign In for Pricing
View Details
MRPL36 Rabbit pAb
MBS9148668-02 0.1 mL

MRPL36 Rabbit pAb

Sign In for Pricing
View Details
MRPL36 Rabbit pAb
MBS9148668-03 5x 0.1 mL

MRPL36 Rabbit pAb

Sign In for Pricing
View Details