Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Caulobacter sp. Undecaprenyl-diphosphatase (uppP)

This Recombinant Caulobacter sp. Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B0T669

Expression Region

1-269

Origin

Caulobacter sp. (strain K31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDWLIAIVLGLVEGLTEFIPVSSTGHLLLTKIALGLTDPAWDTFIVLIQLGAVLGVVAL YFQRLWAVVVGLPTQPEARRFALTVLIGCIPAFAAGLALHGVIKHFFENPYLPQVICVSL ILGGVILLVVDKKAPPPREMDGMALSLKTAALIGLFQCLSLLPGVSRSGSTIVGSMLIGV DRKAAAEFSFFMAIPIMVGAFALDLLKSYKDIDASHAGAIAIGFVVSFLSGLVVVKFLID FVGKRGFTPFAWWRIVVGVIGLGLIYIPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxypicolinic Acid
TRC-H951275-50G 50 g

5-Hydroxypicolinic Acid

Sign In for Pricing
View Details
SLC6A12 Human Gene Knockout Kit (CRISPR)
KN422855 1 Kit

SLC6A12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphorylase B (PHKB) (NM_001031835) Human Recombinant Protein
TP307611 20 µg

Phosphorylase B (PHKB) (NM_001031835) Human Recombinant Protein

Sign In for Pricing
View Details
Cask Mouse Gene Knockout Kit (CRISPR)
KN502559 1 Kit

Cask Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GET3 Mouse Monoclonal Antibody [Clone ID: AT2A1]
AM50078PU-N 100 µL

GET3 Mouse Monoclonal Antibody [Clone ID: AT2A1]

Sign In for Pricing
View Details
Catenin, beta (CTNNB1) (rCTNNB1/2173), CF594 conjugate, 0.1mg/mL
BNC942173-500 1x 500 µL

Catenin, beta (CTNNB1) (rCTNNB1/2173), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details