Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blochmannia pennsylvanicus ATP synthase subunit a (atpB)

This Recombinant Blochmannia pennsylvanicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q494C9

Expression Region

1-269

Origin

Blochmannia pennsylvanicus (strain BPEN)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGIKGTSQEYIGHHLYHLQFDLSTFSLVSSENTSSFWVLNVDSMFFSILLATLFLLIFG RLATVATYAVPTKLQVFIELVILFIDSNVKDMFHGKNKLIAPLSMTVFVWIFLMNTMDLF PIDLFPAIAKLLGLPALRVVPSADVNITSSLALNVFVLVMYYNIYVNGVHGFIKGLMYHP FNHPTCIPINFIIEVVSLLSKPVSLSLRLFGNMYSGELIFILISGLLPWWGQWVLNLPWA IFHILVVTLQAFIFMVLTVIYLSTAHDSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Epidermal 
 Growth Factor (rRtEGF )
JOT-PR3001 20µg

Recombinant Rat Epidermal Growth Factor (rRtEGF )

Sign In for Pricing
View Details
Rabbit high density Lipoprotein2, HDL2 GENLISA ELISA
KLX0095 96 Well

Rabbit high density Lipoprotein2, HDL2 GENLISA ELISA

Sign In for Pricing
View Details
HDAC3 (RPD3-2, SMAP45) (MaxLight 550) discontinued
144650-ML550 100 µL

HDAC3 (RPD3-2, SMAP45) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Sik2 sgRNA CRISPR Lentivector set (Mouse)
K3616901 3x 1.0 µg

Sik2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
MZT2B Rabbit pAb
E45R28823N-50 50 µL

MZT2B Rabbit pAb

Sign In for Pricing
View Details
Lentiviral human SPRR2A sgRNA gene knockout kit - Lentiviral human SPRR2A sgRNA gene knockout kit (25)
GTR15365556 1 Vial

Lentiviral human SPRR2A sgRNA gene knockout kit - Lentiviral human SPRR2A sgRNA gene knockout kit (25)

Sign In for Pricing
View Details