Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Blochmannia pennsylvanicus ATP synthase subunit a (atpB)

This Recombinant Blochmannia pennsylvanicus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q494C9

Expression Region

1-269

Origin

Blochmannia pennsylvanicus (strain BPEN)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGIKGTSQEYIGHHLYHLQFDLSTFSLVSSENTSSFWVLNVDSMFFSILLATLFLLIFG RLATVATYAVPTKLQVFIELVILFIDSNVKDMFHGKNKLIAPLSMTVFVWIFLMNTMDLF PIDLFPAIAKLLGLPALRVVPSADVNITSSLALNVFVLVMYYNIYVNGVHGFIKGLMYHP FNHPTCIPINFIIEVVSLLSKPVSLSLRLFGNMYSGELIFILISGLLPWWGQWVLNLPWA IFHILVVTLQAFIFMVLTVIYLSTAHDSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GINGF2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0858204 1.0 µg DNA

GINGF2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Human GLP2 ELISA Kit
orb407427-01 24 Tests

Human GLP2 ELISA Kit

Sign In for Pricing
View Details
Human GLP2 ELISA Kit
orb407427-02 48 Tests

Human GLP2 ELISA Kit

Sign In for Pricing
View Details
Human GLP2 ELISA Kit
orb407427-03 96 Tests

Human GLP2 ELISA Kit

Sign In for Pricing
View Details
Human GLP2 ELISA Kit
orb407427-04 5 x 96 T

Human GLP2 ELISA Kit

Sign In for Pricing
View Details
Human GLP2 ELISA Kit
orb407427-05 10 x 96 T

Human GLP2 ELISA Kit

Sign In for Pricing
View Details