Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 3 (COX3)

This Recombinant Kluyveromyces lactis Cytochrome c oxidase subunit 3 (COX3) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 3, EC= 1.9.3.1, Cytochrome c oxidase polypeptide III

UniProt

Q9XLW9

Expression Region

1-269

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHLERSRHQQFPFHLVAPSPWPIVVSFALMSLALSLALTMHGYIGHMYLIYLSILTVTL SATLWFRDIIAEATYLGDHTIAVRKGINLGFLLFVVSEILIFAALFWAYFHSAMSPNIEL GGVWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHGLVGGNRKNALSGLLITFWLIVI FVTCQYIEYTNATFTITDGVYGSVFYAGTGLHFLHMVMLAAMLGINYWRLRNYHLTATHH VGYETTVLYCHILDIIWLFLYIVFYWWGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF740 conjugate, 0.1mg/mL
BNC741986-100 1x 100 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details