Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ydaH (ydaH)

This Recombinant Bacillus subtilis Uncharacterized protein ydaH (ydaH) spans the amino acid sequence from region 1-269.

Product Specifications

Product Name Alternative

Uncharacterized protein ydaH

UniProt

P96581

Expression Region

1-269

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHVITTQVLFIFCFLLLIHSIETLAYATRLSGARVGFIASALSLFNVMVIVSRMSNMVQQ PFTGHLIDDAGKNALAIVGEQFRFLIFGSTVGTILGIILLPSFVALFSRAIIHLAGGGGS VFQVFRKGFSKQGFKNALSYLRLPSISYVKGFHMRLIPKRLFVINMLITSIYTIGVLSAL YAGLLAPERSTTAVMASGLINGIATMLLAIFVDPKVSVLADDVAKGKRSYIYLKWTSVTM VTSRVAGTLLAQLMFIPGAYYIAWLTKWF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey IgM Antibody - AP Conjugated
OARA04691-1MG 1 mg

Monkey IgM Antibody - AP Conjugated

Sign In for Pricing
View Details
Dkk-2, NT (Dickkopf Related Protein-2, Dickkopf-2, DKK-2, UNQ682/PRO1316) (Azide free) (HRP)
MBS6472585-01 0.2 mL

Dkk-2, NT (Dickkopf Related Protein-2, Dickkopf-2, DKK-2, UNQ682/PRO1316) (Azide free) (HRP)

Sign In for Pricing
View Details
Dkk-2, NT (Dickkopf Related Protein-2, Dickkopf-2, DKK-2, UNQ682/PRO1316) (Azide free) (HRP)
MBS6472585-02 5x 0.2 mL

Dkk-2, NT (Dickkopf Related Protein-2, Dickkopf-2, DKK-2, UNQ682/PRO1316) (Azide free) (HRP)

Sign In for Pricing
View Details
CSPG4 Antibody
CSB-PA575237-01 50 μL

CSPG4 Antibody

Sign In for Pricing
View Details
CSPG4 Antibody
CSB-PA575237-02 100 µL

CSPG4 Antibody

Sign In for Pricing
View Details
LDLRAD2 Rabbit Polyclonal Antibody
TA359080 100 µL

LDLRAD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details