Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Bacillus cereus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

B7IPS6

Expression Region

1-270

Origin

Bacillus cereus (strain G9842)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLGSVPQLDRVAVQLGPFPVYWYGIIIGTGVLLGLWLATREGERLGIPKDTFVDLVLIA VPIAILFARMYYVIFEWEYYAQNPSQIINIRQGGLAIHGGLIGAVITGILFAKRRGVSFW KLADIAAPSILLGQAIGRWGNFMNQEAHGDEVTRQFLEGLHLPDFIINQMYIEGVYYHPT FLYESLWNFVGVILLLALRKVNLRRGELFFTYLIWYSVGRFFVEGLRTDSLMLGPLRIAQ VMSIGLVVISIIFIIVRRKMGQADKRYSEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF647 conjugate, 0.1mg/mL
BNC470883-500 1x 500 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL
BNUB1073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), 0.2mg/mL

Sign In for Pricing
View Details