Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Phosphatidate cytidylyltransferase (cdsA)

This Recombinant Brucella abortus Phosphatidate cytidylyltransferase (cdsA) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Phosphatidate cytidylyltransferase, EC= 2.7.7.41, CDP-DAG synthase, CDP-DG synthase, CDP-diacylglycerol synthase, CDS, CDP-diglyceride pyrophosphorylase, CDP-diglyceride syn

UniProt

Q2YRP9

Expression Region

1-270

Origin

Brucella abortus (strain 2308)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Others Antibody
orb3169647-01 1 mg

Others Antibody

Sign In for Pricing
View Details
Others Antibody
orb3169647-02 5 mg

Others Antibody

Sign In for Pricing
View Details
Others Antibody
orb3169647-03 10 mg

Others Antibody

Sign In for Pricing
View Details
NLRC5 (D9Z5X) Rabbit Monoclonal Antibody
CST 33343S 100 µL

NLRC5 (D9Z5X) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
KIAA0586 Human qPCR Primer Pair (NM_014749)
HP211122 200 Reactions

KIAA0586 Human qPCR Primer Pair (NM_014749)

Sign In for Pricing
View Details
Canine TNF-α Antibody Pair Set
E-KAB-0397 50 µL & 100 µg

Canine TNF-α Antibody Pair Set

Sign In for Pricing
View Details