Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 2 (uppP2)

This Recombinant Bacillus thuringiensis subsp. konkukian Undecaprenyl-diphosphatase 2 (uppP2) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 2, EC= 3.6.1.27, Bacitracin resistance protein 2, Undecaprenyl pyrophosphate phosphatase 2

UniProt

Q6HND2

Expression Region

1-270

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQFYYILKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGFSFELLVNSASLLAVL LIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGVIGVLFKDYIDQYLKGV KMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQACALIPGISRSGATIVAAM LLGMKQETALRFSFLLYIPVSLGGLLLSITDIAKDPNLDTLFVPYIVAFIATFIMTYISL KWFMNIMAKGNLKYFSFYCIIVGVLTLIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (LcN-2), CF594 conjugate, 0.1mg/mL
BNC940631-500 1x 500 µL

Human Lambda Light Chain (LcN-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF405S conjugate, 0.1mg/mL
BNC042043-100 1x 100 µL

Cytokeratin 16 (KRT16) (Suprabasal Keratinocyte Marker) (KRT16/2043R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL
BNUB0806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL
BNC682873-500 1x 500 µL

CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF594 conjugate, 0.1mg/mL
BNC941561-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details