Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB)

This Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7P0A1

Expression Region

1-270

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASNATDYIKHHLTFWNSDPSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIEAPGR LQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIG YTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSS NPVGAIILAPLNFAFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPWGLQWVLGAPW AIFHILIITLQAFVFMMLTIVYLSLAVEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOS Lentiviral Activation Particles (m2)
sc-430476-LAC-2 200 µL

HOS Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Zfp281 (NM_177643) Mouse Tagged Lenti ORF Clone
MR211084L4 10 µg

Zfp281 (NM_177643) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GPT2 (h) -PR
sc-45647-PR 10 µM - 20 µL

GPT2 (h) -PR

Sign In for Pricing
View Details
THRA (Thyroid Hormone Receptor alpha, AR7, EAR7, ERBA, CHNG6, ERBA1, NR1A1, THRA1, THRA2, ERB-T-1, c-ERBA-1) (MaxLight 750)
MBS6440596-01 0.1 mL

THRA (Thyroid Hormone Receptor alpha, AR7, EAR7, ERBA, CHNG6, ERBA1, NR1A1, THRA1, THRA2, ERB-T-1, c-ERBA-1) (MaxLight 750)

Sign In for Pricing
View Details
THRA (Thyroid Hormone Receptor alpha, AR7, EAR7, ERBA, CHNG6, ERBA1, NR1A1, THRA1, THRA2, ERB-T-1, c-ERBA-1) (MaxLight 750)
MBS6440596-02 5x 0.1 mL

THRA (Thyroid Hormone Receptor alpha, AR7, EAR7, ERBA, CHNG6, ERBA1, NR1A1, THRA1, THRA2, ERB-T-1, c-ERBA-1) (MaxLight 750)

Sign In for Pricing
View Details
WRP siRNA (m)
sc-76930 10 µM

WRP siRNA (m)

Sign In for Pricing
View Details