Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB)

This Recombinant Chromobacterium violaceum ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-270.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q7P0A1

Expression Region

1-270

Origin

Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASNATDYIKHHLTFWNSDPSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIEAPGR LQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIG YTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSS NPVGAIILAPLNFAFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPWGLQWVLGAPW AIFHILIITLQAFVFMMLTIVYLSLAVEAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Complement Component 7 (C7) ELISA Kit
NSL0115Ca 96 Tests

Canine Complement Component 7 (C7) ELISA Kit

Sign In for Pricing
View Details
pLV3-CMV-Lpar4-3×FLAG-CopGFP-Puro Plasmid
PVT50385 2 µg

pLV3-CMV-Lpar4-3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
NPHS1 discontinued
392315 200 µL

NPHS1 discontinued

Sign In for Pricing
View Details
Catalase Rabbit Polyclonal Antibody
orb665526-01 30 µL

Catalase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Catalase Rabbit Polyclonal Antibody
orb665526-02 50 μL

Catalase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Catalase Rabbit Polyclonal Antibody
orb665526-03 100 µL

Catalase Rabbit Polyclonal Antibody

Sign In for Pricing
View Details